Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.

Search Within Results

7,306 – 7,320 of 119,634 results

7,306

Invitrogen™ Influenza A H1N1 HA (A/Puerto Rico/8/1934) His-tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Purity or Quality Grade	≥85% as determined by SDS-PAGE.
Conjugate	Unconjugated
pH Range	8.5
Form	Lyophilized
Molecular Weight (g/mol)	60-70 kDa
Common Name	Influenza A H1N1 HA
Endotoxin Concentration	<1.0 EU/μg
Storage Requirements	-20°C, Avoid Freeze/Thaw Cycles
Sequence	Influenza A virus H1N1 (A/Puerto Rico/8/1934) hemagglutinin, amino acids Met1-Gln528 (Accession # ABD77675.1) with a C-terminal His-tag
Concentration	0.13 mg/mL
Expression System	HEK293 cells
For Use With (Application)	Control,Neutralization
Name	Influenza A H1N1 HA (A/Puerto Rico/8/1934) His-tag
Regulatory Status	RUO
Purification Method	Purified
Gene Alias	flu hemagglutinin; H1N1 HA; H1N1 hemagglutinin; Influenza H1N1; influenza hemagglutinin
Product Type	Protein
Formulation	20mM tris with 0.05% CHAPS, 10% glycerol, 0.2M arginine, 9.56% mannitol, 150mM NaCl, 12.5% trehalose, 0.005% Tween and no preservative; pH 8.5
Protein Tag	His-tag
Recombinant	Recombinant

7,307

R&D Systems™ Recombinant Human TGF-beta 1 (Human Cell-expressed)

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

Pricing & Availability
Specifications

Buffer	Lyophilized from a 0.2μm filtered solution in Acetonitrile and TFA.
Purity or Quality Grade	>95%, by SDS-PAGE under reducing conditions and visualized by silver stain.
Conjugate	Unconjugated
Specific Reactivity	TGF-beta 1
Molecular Weight (g/mol)	12.8 kDa (monomer)
Gene Symbol	TGFB1
Endotoxin Concentration	<0.01 EU per 1 μg of the protein by the LAL method.
Storage Requirements	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 3 months, -20 to -70 °C under sterile conditions after reconstitution.
For Use With (Application)	Bioactivity
Source	Human embryonic kidney cell,HEK293-derived human TGF-beta 1 protein Ala279-Ser390
Accession Number	P01137
Regulatory Status	RUO
Gene Alias	CEDLAP, DPD1, latency-associated peptide, TGF beta1, TGFB, TGFB1, TGFbeta, TGFbeta 1, TGF-beta 1 protein, TGF-beta-1, transforming growth factor beta-1, transforming growth factor, beta 1
Gene ID (Entrez)	7040
Reconstitution	Reconstitute at 100 μg/mL in sterile 4 mM HCl.
Species	Human
Recombinant	Recombinant

7,308

Novus Biologicals™ GLIPR2 Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Purity or Quality Grade	>90%
Conjugate	Unconjugated
Common Name	GLIPR2
Molecular Weight (g/mol)	19.3kDa
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	1mg/mL
For Use With (Application)	ELISA,SDS-PAGE
Source	Recombinant human GLIPR2 protein, fused to His-tag at N-terminus, expressed in E. coli
Accession Number	NP_071738
Regulatory Status	RUO
Purification Method	Protein
Gene ID (Entrez)	152007
Formulation	20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol 1mM DTT, 0.1M NaCl.
Immunogen	GLIPR2, 1-154aa, Human, His tag, E. coli (NP_071738).
Recombinant	Recombinant

7,309

Novus Biologicals™ Methionine Sulfoxide Reductase B Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	Protein
Purity or Quality Grade	>90%
Conjugate	Unconjugated
Common Name	Methionine Sulfoxide Reductase B
Molecular Weight (g/mol)	14.8kDa
Gene ID (Entrez)	51734
Formulation	Liquid. In 20mM Tris-HCl Buffer (pH 7.5) containing 1mM DTT, 0.1mM PMSF, 2mM EDTA, 10% Glycerol
Immunogen	SEPX1(U95C), 1-116aa. MGSSHHHHHHSSGLVPRGSHMSFCSFFGGEVFQNHFEPGVYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAKRPEHNRSEALKVSCGKCGNGLGHEFLNDGPKPGQSRFCIFSSSLKFVPKGKETSASQGH
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	0.5mg/mL
For Use With (Application)	ELISA,SDS-PAGE
Source	Human

7,310

Invitrogen™ Human G-CSF Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Regulatory Status	RUO
Purity or Quality Grade	>95%, by SDS-PAGE under reducing conditions
Conjugate	Unconjugated
Form	Liquid
Molecular Weight (g/mol)	23.19 kDa
Formulation	20 mM tris HCl with 50% glycerol and no preservative; pH 8
Sequence	Amino acids Thr31- Pro204 containing an N-terminal His-tag
Concentration	1.13 mg/mL
For Use With (Application)	Control,Western Blot
Source	E. coli
Name	Human G-CSF
Recombinant	Recombinant